Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryza nivara Photosystem II D2 protein (psbD)

This Recombinant Oryza nivara Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q6ENJ1

Expression Region

1-353

Origin

Oryza nivara (Indian wild rice)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIALGRVTKEENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FALIGFMLRQFELARSVQLRPYNAISFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CXCR7/RDC-1 Phycoerythrin MAb (Clone 358426)
FAB42271P-100 100 Tests

Human CXCR7/RDC-1 Phycoerythrin MAb (Clone 358426)

Sign In for Pricing
View Details
LentimiRa-Off-rno-miR-125b* Vector
mr30050 500 ng

LentimiRa-Off-rno-miR-125b* Vector

Sign In for Pricing
View Details
NucleoSpin® DNA RapidLyse
MN 740100.50 50 Preparations

NucleoSpin® DNA RapidLyse

Sign In for Pricing
View Details
Prostatic Acid Phosphatase (6E2) Mouse mAb
MBS4754068-01 0.1 mL

Prostatic Acid Phosphatase (6E2) Mouse mAb

Sign In for Pricing
View Details
Prostatic Acid Phosphatase (6E2) Mouse mAb
MBS4754068-02 5x 0.1 mL

Prostatic Acid Phosphatase (6E2) Mouse mAb

Sign In for Pricing
View Details
PPIL3 Adenovirus (Rat)
37370056 1.0 mL

PPIL3 Adenovirus (Rat)

Sign In for Pricing
View Details