Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nymphaea alba Photosystem II D2 protein (psbD)

This Recombinant Nymphaea alba Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q6EW53

Expression Region

1-353

Origin

Nymphaea alba (White water-lily) (Castalia alba)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIALGRFTKEENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FGLIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INTS10 (3Z16) Rabbit Monoclonal Antibody
E28M2855 100 µL

INTS10 (3Z16) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Porcine RNA-binding protein PNO1 (PNO1) ELISA Kit
MBS7249139-01 48 Well

Porcine RNA-binding protein PNO1 (PNO1) ELISA Kit

Sign In for Pricing
View Details
Porcine RNA-binding protein PNO1 (PNO1) ELISA Kit
MBS7249139-02 96 Well

Porcine RNA-binding protein PNO1 (PNO1) ELISA Kit

Sign In for Pricing
View Details
Porcine RNA-binding protein PNO1 (PNO1) ELISA Kit
MBS7249139-03 5x 96 Well

Porcine RNA-binding protein PNO1 (PNO1) ELISA Kit

Sign In for Pricing
View Details
Porcine RNA-binding protein PNO1 (PNO1) ELISA Kit
MBS7249139-04 10x 96 Well

Porcine RNA-binding protein PNO1 (PNO1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-Paragonimus IgM ELISA kit
GTR10386030 96 Well

Rabbit Anti-Paragonimus IgM ELISA kit

Sign In for Pricing
View Details