Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Panax ginseng Photosystem II D2 protein (psbD)

This Recombinant Panax ginseng Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q68S11

Expression Region

1-353

Origin

Panax ginseng (Korean ginseng)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIALGKFTEDEKDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FGLIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENLYFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dylight 350 Conjugated Succinyl Triticum vulgare Lectin (Wheat Germ), -Succinyl WGA-
DY350-2102-1 1 mg

Dylight 350 Conjugated Succinyl Triticum vulgare Lectin (Wheat Germ), -Succinyl WGA-

Sign In for Pricing
View Details
Variable Volume Single Channel Micropipette BPIP-522
BPIP-522 1 Unit

Variable Volume Single Channel Micropipette BPIP-522

Sign In for Pricing
View Details
ATP1A3 Recombinant Rabbit Monoclonal Antibody [JE35-24]
HA721596 100 µL

ATP1A3 Recombinant Rabbit Monoclonal Antibody [JE35-24]

Sign In for Pricing
View Details
2-Chloro-N,N-diethylethylamine Hydrochloride
TRC-C421850-25G 25 g

2-Chloro-N,N-diethylethylamine Hydrochloride

Sign In for Pricing
View Details
Alpha-Bungarotoxin, CF®680R, 500 ug
#00003 1x 500 µg

Alpha-Bungarotoxin, CF®680R, 500 ug

Sign In for Pricing
View Details
Cytokeratin 8 (H1 + TS1), CF568 conjugate, 0.1mg/mL
BNC680687-500 1x 500 µL

Cytokeratin 8 (H1 + TS1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details