Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem II D2 protein (psbD)

This Recombinant Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q70Y08

Expression Region

1-353

Origin

Amborella trichopoda

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIALGRFSKEENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FGLIGFMLRQFELARSVQLRPYNAIAFSAPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MVP Rabbit Monoclonal Antibody
TA423351 100 µL

MVP Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
1,2-Dipalmityl-sn-glycero-3-Phosphoethanolamine-N-(cap biotinyl) Sodium Salt
TRC-D487055-25MG 25 mg

1,2-Dipalmityl-sn-glycero-3-Phosphoethanolamine-N-(cap biotinyl) Sodium Salt

Sign In for Pricing
View Details
FAM227A (NM_001013647) Human Over-expression Lysate
LC431490 20 µg

FAM227A (NM_001013647) Human Over-expression Lysate

Sign In for Pricing
View Details
Vps25 Mouse Gene Knockout Kit (CRISPR)
KN519246 1 Kit

Vps25 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human DOT1L/KMT4 Protein
PKSH031093 50 µg

Recombinant Human DOT1L/KMT4 Protein

Sign In for Pricing
View Details
c-Met Mouse Monoclonal Antibody [A9A4]
HA601092 100 µL

c-Met Mouse Monoclonal Antibody [A9A4]

Sign In for Pricing
View Details