Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem II D2 protein (psbD)

This Recombinant Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q70Y08

Expression Region

1-353

Origin

Amborella trichopoda

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIALGRFSKEENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FGLIGFMLRQFELARSVQLRPYNAIAFSAPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Orthovanadate
TRC-S655003-5G 5 g

Sodium Orthovanadate

Sign In for Pricing
View Details
NPW (NM_001099456) Human Over-expression Lysate
LC420463 20 µg

NPW (NM_001099456) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Ephrin A2 (EFNA2) activation kit by CRISPRa
GA101342 1 Kit

Human Ephrin A2 (EFNA2) activation kit by CRISPRa

Sign In for Pricing
View Details
TMEM176B (NM_001101311) Human Over-expression Lysate
LY420312 100 µg

TMEM176B (NM_001101311) Human Over-expression Lysate

Sign In for Pricing
View Details
Chloroquine Diphosphate Salt
TRC-C379965-50MG 50 mg

Chloroquine Diphosphate Salt

Sign In for Pricing
View Details
FAAH1 Recombinant Rabbit Monoclonal Antibody [JG43-07]
ET7109-06 100 µL

FAAH1 Recombinant Rabbit Monoclonal Antibody [JG43-07]

Sign In for Pricing
View Details