Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem II D2 protein (psbD)

This Recombinant Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q7Y4H2

Expression Region

1-353

Origin

Synechococcus phage S-PM2

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSSTLSQPIKQRGWFDVLDDWIKRDRFVFVGWSGLLLFPTAYLALGGWLTGTTFVTSWY THGLASSYLEGANFLTAAVSTPADAMGHSLLLLWGPESQGDIVRWFQLGGLWTFVALHGA FSLIGFMLRQFEISRLVGIRPYNAIAFSGPIAVFVSVFLMYPLGQSSWFFAPSFGVAAIF RFLLFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLYEDGEQSNTFKAFEPTQ EEETYSMVTANRYWSQIFGIAFSNKRWLHFFMLFVPVMGLWTSSIGIIGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGLRAWMAPVDQPHENFVFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Leukocyte Immunoglobulin Like Receptor Subfamily B, Member 4 (LILRB4) ELISA Kit
RDR-LILRB4-Hu-01 96 Tests

Human Leukocyte Immunoglobulin Like Receptor Subfamily B, Member 4 (LILRB4) ELISA Kit

Sign In for Pricing
View Details
Human Leukocyte Immunoglobulin Like Receptor Subfamily B, Member 4 (LILRB4) ELISA Kit
RDR-LILRB4-Hu-02 48 Tests

Human Leukocyte Immunoglobulin Like Receptor Subfamily B, Member 4 (LILRB4) ELISA Kit

Sign In for Pricing
View Details
UPB1 Rabbit Polyclonal Antibody
TA383110 100 µL

UPB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR561728 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
IFluor® 840-streptavidin conjugate
16978-AAT 200 µg

IFluor® 840-streptavidin conjugate

Sign In for Pricing
View Details
Tissue Total RNA, Liver
CR562912 5 µg

Tissue Total RNA, Liver

Sign In for Pricing
View Details