Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem II D2 protein (psbD)

This Recombinant Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q8M9W4

Expression Region

1-353

Origin

Chaetosphaeridium globosum

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAIGKSSKEPKGLFDSMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWLTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVAFHGA FGLIGFMLRQFEIARSVQLRPYNAIAFTGPIAVFVSVFLIYPLGQSGWFFAPSFGVAGIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTIFEDGDGANTFRAFNPTQ AEETYSFVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAVGVVGLAVNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLVFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl (1R,5R,6R)-7-acetyl-5-(pentan-3-yloxy)-7-azabicyclo[4.1.0]hept-3-ene-3-carboxylate
TRC-E295380-10MG 10 mg

Ethyl (1R,5R,6R)-7-acetyl-5-(pentan-3-yloxy)-7-azabicyclo[4.1.0]hept-3-ene-3-carboxylate

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/1120), 1mg/mL
BNUM1120-50 1x 50 µL

Ep-CAM / CD326 (EGP40/1120), 1mg/mL

Sign In for Pricing
View Details
ATE1 Rabbit Monoclonal Antibody
TA423427 100 µL

ATE1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ATPBD3 (CTU1) (Center) Rabbit Polyclonal Antibody
AP50309PU-N 400 µL

ATPBD3 (CTU1) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 1 (Suprabasal Keratinocyte Marker) (LHK1), CF647 conjugate, 0.1mg/mL
BNC471660-100 1x 100 µL

Cytokeratin 1 (Suprabasal Keratinocyte Marker) (LHK1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Activin Receptor Type IA (ACVR1) Rabbit Polyclonal Antibody
AP13706PU-N 400 µL

Activin Receptor Type IA (ACVR1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details