Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Membrane protein insertase YidC (yidC)

This Recombinant Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

Q9L7M1

Expression Region

1-353

Origin

Mycobacterium paratuberculosis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLLFDFFSLDFVYYPVSWIMWVWYKLFAAMLGPSNFFAWALSVMFLVFTLRALLYKPFV RQIRTTRQMQELQPQIKALQKKYGKDRQRMALEMQKLQREHGFNPILGCLPMLAQIPVFL GLYHVLRSFNRTTGGFGQPHLSVVQNRLTGNYVFTPTDVGHFLDANLFGAPIGAFMTQRT GLDAFTYFSRPAVIAVGLPVMILAGVATYFNSRASVARQSPEAAANPQTAMMNKLALYVF PLGVVVGGPFLPLAIILYWFANNIWTFGQQHYVFGMIEKEDEAKKQEAIQRRAANAPAPG AKPKRNLKAGAGNGVDADAAQPDAGATEGQAGGGSDAPSRTPRPGARPKKRKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,5,6-Trihydroxy-1-isopropylindole
TRC-T795285-25MG 25 mg

3,5,6-Trihydroxy-1-isopropylindole

Sign In for Pricing
View Details
Edf1 (NM_021519) Mouse Tagged ORF Clone
MG201022 10 µg

Edf1 (NM_021519) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Mouse IgG2b,  15nm
GM-302-15 1 mL

Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Mouse IgG2b, 15nm

Sign In for Pricing
View Details
PDE4DIP (NM_001002812) Human Over-expression Lysate
LY424160 100 µg

PDE4DIP (NM_001002812) Human Over-expression Lysate

Sign In for Pricing
View Details
Vmn2r11 Mouse Gene Knockout Kit (CRISPR)
KN519124 1 Kit

Vmn2r11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Loratadine Impurity 5 Hydrochloride
TRC-L491140-25MG 25 mg

Loratadine Impurity 5 Hydrochloride

Sign In for Pricing
View Details