Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Membrane protein insertase YidC (yidC)

This Recombinant Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

Q9L7M1

Expression Region

1-353

Origin

Mycobacterium paratuberculosis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLLFDFFSLDFVYYPVSWIMWVWYKLFAAMLGPSNFFAWALSVMFLVFTLRALLYKPFV RQIRTTRQMQELQPQIKALQKKYGKDRQRMALEMQKLQREHGFNPILGCLPMLAQIPVFL GLYHVLRSFNRTTGGFGQPHLSVVQNRLTGNYVFTPTDVGHFLDANLFGAPIGAFMTQRT GLDAFTYFSRPAVIAVGLPVMILAGVATYFNSRASVARQSPEAAANPQTAMMNKLALYVF PLGVVVGGPFLPLAIILYWFANNIWTFGQQHYVFGMIEKEDEAKKQEAIQRRAANAPAPG AKPKRNLKAGAGNGVDADAAQPDAGATEGQAGGGSDAPSRTPRPGARPKKRKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2711), CF647 conjugate, 0.1mg/mL
BNC472711-500 1x 500 µL

Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2711), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CF®725 Tyramide
#96128 1x 0.5 mg

CF®725 Tyramide

Sign In for Pricing
View Details
Desmoglein-3 (Squamous Cell Marker) (DSG3/2838), CF568 conjugate, 0.1mg/mL
BNC682838-500 1x 500 µL

Desmoglein-3 (Squamous Cell Marker) (DSG3/2838), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ReadiView™ biotin succinimidyl ester
3059-AAT 5 mg

ReadiView™ biotin succinimidyl ester

Sign In for Pricing
View Details
SMAD3 Rabbit Polyclonal Antibody
AP06414PU-N 100 µg

SMAD3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD268 Antibody[11C1]
AN00316M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD268 Antibody[11C1]

Sign In for Pricing
View Details