Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Populus deltoides Photosystem II D2 protein (psbD)

This Recombinant Populus deltoides Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q9XQA8

Expression Region

1-353

Origin

Populus deltoides (Eastern poplar) (Eastern cottonwood)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIALGKFTKDENDLFDIMDDWLRRDRFVFVGWSGLLVFPCAYFALGGWFTGTTFVTSWY THGWASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGFWTFVALHGA FGLIGFMLRQFELARSVQLRPYNAIAFSAPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 10 (KRT10) Rabbit Polyclonal Antibody
TA377901 100 µL

Cytokeratin 10 (KRT10) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PARP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F1]
TA804938BM 100 µL

PARP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F1]

Sign In for Pricing
View Details
APC Anti-Mouse CD34 Antibody[RAM34]
E-AB-F1284E-01 50 Tests

APC Anti-Mouse CD34 Antibody[RAM34]

Sign In for Pricing
View Details
APC Anti-Mouse CD34 Antibody[RAM34]
E-AB-F1284E-02 100 Tests

APC Anti-Mouse CD34 Antibody[RAM34]

Sign In for Pricing
View Details
APC Anti-Mouse CD34 Antibody[RAM34]
E-AB-F1284E-03 2x 100 Tests

APC Anti-Mouse CD34 Antibody[RAM34]

Sign In for Pricing
View Details
OSCAR Antibody
KC-7412-01 50 μL

OSCAR Antibody

Sign In for Pricing
View Details