Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Populus deltoides Photosystem II D2 protein (psbD)

This Recombinant Populus deltoides Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q9XQA8

Expression Region

1-353

Origin

Populus deltoides (Eastern poplar) (Eastern cottonwood)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIALGKFTKDENDLFDIMDDWLRRDRFVFVGWSGLLVFPCAYFALGGWFTGTTFVTSWY THGWASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGFWTFVALHGA FGLIGFMLRQFELARSVQLRPYNAIAFSAPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM104B (NM_138362) Human Recombinant Protein
TP761614 50 µg

FAM104B (NM_138362) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human C1QBP Protein (aa 75-282, His Tag)
PKSH030979 100 µg

Recombinant Human C1QBP Protein (aa 75-282, His Tag)

Sign In for Pricing
View Details
Amylite™ Red
23040-AAT 100 Tests

Amylite™ Red

Sign In for Pricing
View Details
ZNF583 (NM_001159861) Human Over-expression Lysate
LC431990 20 µg

ZNF583 (NM_001159861) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse S100a10 activation kit by CRISPRa
GA203743 1 Kit

Mouse S100a10 activation kit by CRISPRa

Sign In for Pricing
View Details
Human ANKRD22 activation kit by CRISPRa
GA114678 1 Kit

Human ANKRD22 activation kit by CRISPRa

Sign In for Pricing
View Details