Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryza sativa Photosystem II D2 protein (psbD)

This Recombinant Oryza sativa Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

P0C435

Expression Region

1-353

Origin

Oryza sativa (Rice)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIALGRVTKEENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FALIGFMLRQFELARSVQLRPYNAISFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcl-6 (Follicular Lymphoma Marker) (BCL6/2497R), CF405S conjugate, 0.1mg/mL
BNC042497-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/2497R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyba (NM_007806) Mouse Tagged ORF Clone
MG201856 10 µg

Cyba (NM_007806) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Purified Anti-Human TRAV5 Antibody[MH3-2]
AN003690P-01 25 µg

Purified Anti-Human TRAV5 Antibody[MH3-2]

Sign In for Pricing
View Details
Purified Anti-Human TRAV5 Antibody[MH3-2]
AN003690P-02 100 µg

Purified Anti-Human TRAV5 Antibody[MH3-2]

Sign In for Pricing
View Details
rac 2-Isopropyl Pentanoic Acid (Sodium Valproate Impurity C)
TRC-I872870-50MG 50 mg

rac 2-Isopropyl Pentanoic Acid (Sodium Valproate Impurity C)

Sign In for Pricing
View Details
Gastrin (GAST/2633), CF640R conjugate, 0.1mg/mL
BNC402633-100 1x 100 µL

Gastrin (GAST/2633), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details