Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryza sativa Photosystem II D2 protein (psbD)

This Recombinant Oryza sativa Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

P0C435

Expression Region

1-353

Origin

Oryza sativa (Rice)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIALGRVTKEENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FALIGFMLRQFELARSVQLRPYNAISFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFYVE27 (NM_001002261) Human Over-expression Lysate
LC424194 20 µg

ZFYVE27 (NM_001002261) Human Over-expression Lysate

Sign In for Pricing
View Details
Factor XIIIa (F13A1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8E2]
TA800393BM 100 µL

Factor XIIIa (F13A1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8E2]

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF488A conjugate, 0.1mg/mL
BNC881025-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TMEM198 (NM_001005209) Human Over-expression Lysate
LC423801 20 µg

TMEM198 (NM_001005209) Human Over-expression Lysate

Sign In for Pricing
View Details
16-Deacetylfusidic Acid gamma-Lactone
TRC-D199075-25MG 25 mg

16-Deacetylfusidic Acid gamma-Lactone

Sign In for Pricing
View Details
CHD3 Mouse Monoclonal Antibody [Clone ID: 2G4]
AM06458SU-N 100 µg

CHD3 Mouse Monoclonal Antibody [Clone ID: 2G4]

Sign In for Pricing
View Details