Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryza sativa subsp. indica Photosystem II D2 protein (psbD)

This Recombinant Oryza sativa subsp. indica Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

P0C436

Expression Region

1-353

Origin

Oryza sativa subsp. indica (Rice)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIALGRVTKEENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FALIGFMLRQFELARSVQLRPYNAISFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CORO6 Rabbit Polyclonal Antibody
TA365682 100 µL

CORO6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (CALD1/820), CF488A conjugate, 0.1mg/mL
BNC880820-100 1x 100 µL

Caldesmon, HMW (h-Caldesmon) (CALD1/820), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Hepatoma Derived Growth Factor (HDGF) ELISA Kit
RD-HDGF-Hu-01 96 Tests

Human Hepatoma Derived Growth Factor (HDGF) ELISA Kit

Sign In for Pricing
View Details
Human Hepatoma Derived Growth Factor (HDGF) ELISA Kit
RD-HDGF-Hu-02 48 Tests

Human Hepatoma Derived Growth Factor (HDGF) ELISA Kit

Sign In for Pricing
View Details
AMPK alpha 1 (PRKAA1) Rabbit Monoclonal Antibody
TA422387 100 µL

AMPK alpha 1 (PRKAA1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ELP1 Antibody
OC-237-01 50 μL

ELP1 Antibody

Sign In for Pricing
View Details