Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem II D2 protein (psbD)

This Recombinant Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-354.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q9MUW2

Expression Region

1-354

Origin

Mesostigma viride

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTISIDKSVKKAEPSIFDLCDDWLKRDRFVFIGWSGLLLLPCAYFALGGFFTGNTFVTSW YTHGLASSYLEGCNVLTAAVSTPSNAMGHSLLLLWGPEAQGDFTRWCQLGGLWTFTALHG AFGLIGFMLRQFEIARAVKIRPYNAIAFSGPIAVFVSVFLIYPLGQQSWFFAPSFGVAAI FRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDAANTFRAFNPT QSEETYSMVTANRFWSQIFGVAFANKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDF VSQEIRAAEDPEFETFYTKNLLLNEGIRAWMAAQDQPHENLVFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CD141/THBD Protein, N-His
YMC23801 100 μg

Recombinant Mouse CD141/THBD Protein, N-His

Sign In for Pricing
View Details
Human ANHX Protein Lysate 20ug
IHUANHXPLLY20UG 20 µg

Human ANHX Protein Lysate 20ug

Sign In for Pricing
View Details
Camk1g, CT (Camk1g, Calcium/calmodulin-dependent protein kinase type 1G, CaM kinase I gamma, CaMK-like CREB kinase III) (Azide free) (HRP) discontinued
033159-HRP 200 µL

Camk1g, CT (Camk1g, Calcium/calmodulin-dependent protein kinase type 1G, CaM kinase I gamma, CaMK-like CREB kinase III) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
TIMM8B (Mitochondrial Import Inner Membrane Translocase Subunit Tim8 B, TIM8B, DDP-like Protein, DDPL, Deafness Dystonia Protein 2, DDP2) (HRP)
134452-HRP 100 µL

TIMM8B (Mitochondrial Import Inner Membrane Translocase Subunit Tim8 B, TIM8B, DDP-like Protein, DDPL, Deafness Dystonia Protein 2, DDP2) (HRP)

Sign In for Pricing
View Details
PRKAG1 (5'-AMP-activated Protein Kinase Subunit gamma-1, AMPK gamma1, AMPK Subunit gamma-1, AMPKg, AMPKG, MGC8666)
131788 100 µg

PRKAG1 (5'-AMP-activated Protein Kinase Subunit gamma-1, AMPK gamma1, AMPK Subunit gamma-1, AMPKg, AMPKG, MGC8666)

Sign In for Pricing
View Details
CCDC39 (NM_181426) Human Untagged Clone
SC317151 10 µg

CCDC39 (NM_181426) Human Untagged Clone

Sign In for Pricing
View Details