Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus halodurans UPF0421 protein BH2644 (BH2644)

This Recombinant Bacillus halodurans UPF0421 protein BH2644 (BH2644) spans the amino acid sequence from region 1-354.

Product Specifications

Product Name Alternative

UPF0421 protein BH2644

UniProt

Q9K9K2

Expression Region

1-354

Origin

Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEISGFMKHPWIGRRVLKTGLAVCLTTAICMAFNLSPTFAVISAIVTTEPTAADSLKKGL IRLPAAALGAFFAVLSAYFFGQTPITYAIVSMITIAVCARLRLDAGTLVATLTAVAMIPS TTDHLFADYVSRVAGTSLGIMISTFVNFMILPPKFGPILMNKVEKMFAMLSSELKLVTTK VVDFEKEETMTSYRTLHHHLSETYKLTTFQHDEWKYRKSSSSEKRSFTYLHRKLDYVYKA LAHLGKIGQIRLKKPLSVKERQLVLSFLVSLTNILQDPLHQIHTEHYALARQLEDAMHKK KDATEPIHRLLSELISLHDLTVELEQCTADERRFSLEERAYPSYIFLERLRPSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL
BNC680266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF594 conjugate, 0.1mg/mL
BNC940851-100 1x 100 µL

HSP60 (LK1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF640R conjugate, 0.1mg/mL
BNC400177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF640R conjugate, 0.1mg/mL
BNC400032-100 1x 100 µL

MUC2 (CCP58), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL
BNC471231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF594 conjugate, 0.1mg/mL
BNC940345-100 1x 100 µL

CD4 (EDU-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details