Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Peripherin-2 (PRPH2)

This Recombinant Chicken Peripherin-2 (PRPH2) spans the amino acid sequence from region 1-354.

Product Specifications

Product Name Alternative

Peripherin-2, CRDS1, Photoreceptor outer segment membrane glycoprotein 1, Retinal degeneration slow protein

UniProt

O42281

Expression Region

1-354

Origin

Gallus gallus (Chicken)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALLKVKFNQKKRVKLAQGLWLMNWFSVFAGIIVFSMGLFLKIELRKRSEVMDNSESHFV PNSLILMGILSCAFNGFAGKICYDSLDPAKFAKWKPLLKPYLALCFFFNILLFFVALICF LMRGSLESTLAQGLKNSMKFYRDTDTPGRCFMKKTIDMLQIEFKCCGNNGFKDWFEIQWI SNRYLDFSSKEVKDRIKSNVDGRYLVDGVPFSCCNPSSPRPCIQYQVTNNSAHYSYDYQT EELNLWGRGCREALLHYYSSMMSSMGAVVLLVWLFEMSVMVGLRLLHTSLESIANPEDPE CESEGWILENSLKDTLKSALESLKKIGKFNQVEAGAEGAEGEEAGKTPAITTVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gsg1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6581603 1.0 µg DNA

Gsg1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Potassium tetracyanoplatinate (II) trihydrate
sc-272112 1 g

Potassium tetracyanoplatinate (II) trihydrate

Sign In for Pricing
View Details
Trp53bp1 3'UTR Luciferase Stable Cell Line
TU121167 1.0 mL

Trp53bp1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
SERPINI2 AAV siRNA Pooled Vector
43508161 1.0 µg

SERPINI2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
EYA2 Peptide - middle region (AAP76136)
AAP76136-100UG 100 µg

EYA2 Peptide - middle region (AAP76136)

Sign In for Pricing
View Details
ZNF831 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
51871111 3x 1.0 µg

ZNF831 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details