Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Peripherin-2 (PRPH2)

This Recombinant Chicken Peripherin-2 (PRPH2) spans the amino acid sequence from region 1-354.

Product Specifications

Product Name Alternative

Peripherin-2, CRDS1, Photoreceptor outer segment membrane glycoprotein 1, Retinal degeneration slow protein

UniProt

O42281

Expression Region

1-354

Origin

Gallus gallus (Chicken)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALLKVKFNQKKRVKLAQGLWLMNWFSVFAGIIVFSMGLFLKIELRKRSEVMDNSESHFV PNSLILMGILSCAFNGFAGKICYDSLDPAKFAKWKPLLKPYLALCFFFNILLFFVALICF LMRGSLESTLAQGLKNSMKFYRDTDTPGRCFMKKTIDMLQIEFKCCGNNGFKDWFEIQWI SNRYLDFSSKEVKDRIKSNVDGRYLVDGVPFSCCNPSSPRPCIQYQVTNNSAHYSYDYQT EELNLWGRGCREALLHYYSSMMSSMGAVVLLVWLFEMSVMVGLRLLHTSLESIANPEDPE CESEGWILENSLKDTLKSALESLKKIGKFNQVEAGAEGAEGEEAGKTPAITTVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPIL2 Rabbit Polyclonal Antibody
orb1743956 100 µg

PPIL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KCNIP4, NT (KCNIP4, CALP, KCHIP4, Kv channel-interacting protein 4, A-type potassium channel modulatory protein 4, Calsenilin-like protein, Potassium channel-interacting protein 4)
037319 200 µL

KCNIP4, NT (KCNIP4, CALP, KCHIP4, Kv channel-interacting protein 4, A-type potassium channel modulatory protein 4, Calsenilin-like protein, Potassium channel-interacting protein 4)

Sign In for Pricing
View Details
OOCA00288-25T - Human C1D Primer Pair 2
OOCA00288-25T 25 Tests

OOCA00288-25T - Human C1D Primer Pair 2

Sign In for Pricing
View Details
LRRC39 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1235708 1.0 µg DNA

LRRC39 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Gli1 polyclonal antibody
BS90575 50ul

Gli1 polyclonal antibody

Sign In for Pricing
View Details
FHL-1 (h) -PR
sc-37889-PR 10 µM - 20 µL

FHL-1 (h) -PR

Sign In for Pricing
View Details