Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Peripherin-2 (PRPH2)

This Recombinant Chicken Peripherin-2 (PRPH2) spans the amino acid sequence from region 1-354.

Product Specifications

Product Name Alternative

Peripherin-2, CRDS1, Photoreceptor outer segment membrane glycoprotein 1, Retinal degeneration slow protein

UniProt

O42281

Expression Region

1-354

Origin

Gallus gallus (Chicken)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALLKVKFNQKKRVKLAQGLWLMNWFSVFAGIIVFSMGLFLKIELRKRSEVMDNSESHFV PNSLILMGILSCAFNGFAGKICYDSLDPAKFAKWKPLLKPYLALCFFFNILLFFVALICF LMRGSLESTLAQGLKNSMKFYRDTDTPGRCFMKKTIDMLQIEFKCCGNNGFKDWFEIQWI SNRYLDFSSKEVKDRIKSNVDGRYLVDGVPFSCCNPSSPRPCIQYQVTNNSAHYSYDYQT EELNLWGRGCREALLHYYSSMMSSMGAVVLLVWLFEMSVMVGLRLLHTSLESIANPEDPE CESEGWILENSLKDTLKSALESLKKIGKFNQVEAGAEGAEGEEAGKTPAITTVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TBC1D10B Antibody
CQA7466-01 30 µL

Anti-TBC1D10B Antibody

Sign In for Pricing
View Details
Anti-TBC1D10B Antibody
CQA7466-02 50 μL

Anti-TBC1D10B Antibody

Sign In for Pricing
View Details
Anti-TBC1D10B Antibody
CQA7466-03 100 µL

Anti-TBC1D10B Antibody

Sign In for Pricing
View Details
Anti-TBC1D10B Antibody
CQA7466-04 200 µL

Anti-TBC1D10B Antibody

Sign In for Pricing
View Details
POMGNT1 siRNA (Human)
orb1857476-01 15 nmol

POMGNT1 siRNA (Human)

Sign In for Pricing
View Details
POMGNT1 siRNA (Human)
orb1857476-02 30 nmol

POMGNT1 siRNA (Human)

Sign In for Pricing
View Details