Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yop proteins translocation protein U (yscU)

This Recombinant Yop proteins translocation protein U (yscU) spans the amino acid sequence from region 1-354.

Product Specifications

Product Name Alternative

Yop proteins translocation protein U

UniProt

P69987

Expression Region

1-354

Origin

Yersinia pseudotuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGEKTEQPTPKKIRDARKKGQVAKSKEVVSTALIVALSAMLMGLSDYYFEHFSKLMLIP AEQSYLPFSQALSYVVDNVLLEFFYLCFPLLTVAALMAIASHVVQYGFLISGEAIKPDIK KINPIEGAKRIFSIKSLVEFLKSILKVVLLSILIWIIIKGNLVTLLQLPTCGIECITPLL GQILRQLMVICTVGFVVISIADYAFEYYQYIKELKMSKDEIKREYKEMEGSPEIKSKRRQ FHQEIQSRNMRENVKRSSVVVANPTHIAIGILYKRGETPLPLVTFKYTDAQVQTVRKIAE EEGVPILQRIPLARALYWDALVDHYIPAEQIEATAEVLRWLERQNIEKQHSEML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sec-Butyl Mercaptan
TRC-B692690-5G 5 g

sec-Butyl Mercaptan

Sign In for Pricing
View Details
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2743), CF647 conjugate, 0.1mg/mL
BNC472743-500 1x 500 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2743), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ARL4 (ARL4A) (NM_001037164) Human Over-expression Lysate
LC425611 20 µg

ARL4 (ARL4A) (NM_001037164) Human Over-expression Lysate

Sign In for Pricing
View Details
EGR1 Mouse Monoclonal Antibody [Clone ID: 8A6]
AM06427SU-N 100 µL

EGR1 Mouse Monoclonal Antibody [Clone ID: 8A6]

Sign In for Pricing
View Details
Desmin (Muscle Cell Marker) (DES/2960R), CF488A conjugate, 0.1mg/mL
BNC882960-100 1x 100 µL

Desmin (Muscle Cell Marker) (DES/2960R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGIF2LY (NM_139214) Human Recombinant Protein
TP321598 20 µg

TGIF2LY (NM_139214) Human Recombinant Protein

Sign In for Pricing
View Details