Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yop proteins translocation protein U (yscU)

This Recombinant Yop proteins translocation protein U (yscU) spans the amino acid sequence from region 1-354.

Product Specifications

Product Name Alternative

Yop proteins translocation protein U

UniProt

P69987

Expression Region

1-354

Origin

Yersinia pseudotuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGEKTEQPTPKKIRDARKKGQVAKSKEVVSTALIVALSAMLMGLSDYYFEHFSKLMLIP AEQSYLPFSQALSYVVDNVLLEFFYLCFPLLTVAALMAIASHVVQYGFLISGEAIKPDIK KINPIEGAKRIFSIKSLVEFLKSILKVVLLSILIWIIIKGNLVTLLQLPTCGIECITPLL GQILRQLMVICTVGFVVISIADYAFEYYQYIKELKMSKDEIKREYKEMEGSPEIKSKRRQ FHQEIQSRNMRENVKRSSVVVANPTHIAIGILYKRGETPLPLVTFKYTDAQVQTVRKIAE EEGVPILQRIPLARALYWDALVDHYIPAEQIEATAEVLRWLERQNIEKQHSEML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (rIG266), CF488A conjugate, 0.1mg/mL
BNC881789-100 1x 100 µL

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (rIG266), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cdk5 Mouse Gene Knockout Kit (CRISPR)
KN303042LP 1 Kit

Cdk5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human SLC2A11 activation kit by CRISPRa
GA112285 1 Kit

Human SLC2A11 activation kit by CRISPRa

Sign In for Pricing
View Details
Human PCBP3 activation kit by CRISPRa
GA110052 1 Kit

Human PCBP3 activation kit by CRISPRa

Sign In for Pricing
View Details
Amplite® Colorimetric BCA Protein Quantitation Assay Kit
11115-AAT 1000 Tests

Amplite® Colorimetric BCA Protein Quantitation Assay Kit

Sign In for Pricing
View Details
SCCPDH Polyclonal Antibody
E-AB-19034-01 20 µL

SCCPDH Polyclonal Antibody

Sign In for Pricing
View Details