Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus UPF0421 protein BCE33L2478 (BCE33L2478)

This Recombinant Bacillus cereus UPF0421 protein BCE33L2478 (BCE33L2478) spans the amino acid sequence from region 1-355.

Product Specifications

Product Name Alternative

UPF0421 protein BCE33L2478

UniProt

Q63AK0

Expression Region

1-355

Origin

Bacillus cereus (strain ZK / E33L)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNQVRKWNIIGGRVIKTGIAVFLTVLVCEFFNIPTIFAVITAIVTIEPTATDSIKKGLVR FPASTIGSAYAMTFTFFLGHQALSYALAAMFTIVTCQKLRLHAGTLVATLTAVAMIPITA DHYFTAFLIRLATTSTGIIVSTVVNFFILPPHYVKTISGCTEELFVKTANVMEEWLTALM DGKVIKKETTYNLSKLTVLLHKAVQFVQYEQKDWKYHRHTKKEMRSFLLVQKQLHLLQQI IYHIDNLARAPIETCDWSQNEKEILRRTIHSIISILRNHCEKIDEEHFKLIDELDKQFWT NKNDLAHCKPNQYHHHFSSESIILFEILSIHDMLEELKQIFEKYESENQLNCSVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL
BNC680225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL
BNC400225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL
BNC680040-500 1x 500 µL

CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL
BNC401037-500 1x 500 µL

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF405S conjugate, 0.1mg/mL
BNC040176-100 1x 100 µL

CD5 (Cris-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL
BNC470034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details