Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Kluyveromyces lactis Palmitoyltransferase ERF2 (ERF2)

This Recombinant Kluyveromyces lactis Palmitoyltransferase ERF2 (ERF2) spans the amino acid sequence from region 1-355.

Product Specifications

Product Name Alternative

Palmitoyltransferase ERF2, EC= 2.3.1.-, DHHC cysteine-rich domain-containing protein ERF2, Ras protein acyltransferase

UniProt

Q6CQB5

Expression Region

1-355

Origin

Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIERFMRNDKDRPSARDGQQNGTNDDSYFVKFLHWIITLDTYDGSSRNYGRMTETTNYTF FFGGRVRTVTKTSVYSIVVFAMFIVPLILFSIFECNYLWHHKGTNWKPAIVILYYFYLLT ICSFLRAACSDPGIVPRNVHIPDLNASYKIPQEYYNYAILPTKNPNASVSMKYCQTCRIW RPPRSAHCSVCDVCVLSHDHHCKWLNNCIGKRNYRFFLEFLMASTISCILLILLSSFRLS YSPQVRYTPVSLLIICYCGLGIWYPLILFIYHIFLAGTQQTTHEYLRSIGSKHPIFHKIT RNRDSPYDRNSMFFNLIHLWFQERGWNLVDPRRKQHYPADIRFRKLPEAHSFETV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL
BNC680158-500 1x 500 µL

Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL
BNC040994-500 1x 500 µL

TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF488A conjugate, 0.1mg/mL
BNC880994-100 1x 100 µL

TNF alpha (J2D10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D205), CF640R conjugate, 0.1mg/mL
BNC400205-500 1x 500 µL

Complement C4d (C4D205), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100B (Astrocyte and Melanoma Marker) (S100B/1706R), CF568 conjugate, 0.1mg/mL
BNC681706-500 1x 500 µL

S100B (Astrocyte and Melanoma Marker) (S100B/1706R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (MUC1/967), CF568 conjugate, 0.1mg/mL
BNC680967-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/967), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details