Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tetraspanin-10 (TSPAN10)

This Recombinant Human Tetraspanin-10 (TSPAN10) spans the amino acid sequence from region 1-355.

Product Specifications

Product Name Alternative

Tetraspanin-10, Tspan-10, Oculospanin

UniProt

Q9H1Z9

Expression Region

1-355

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEGERSPLLSQETAGQKPLSVHRPPTSGCLGPVPREDQAEAWGCSCCPPETKHQALSGT PKKGPAPSLSPGSSCVKYLIFLSNFPFSLLGLLALAIGLWGLAVKGSLGSDLGGPLPTDP MLGLALGGLVVSAASLAGCLGALCENTCLLRGFSGGILAFLVLEAVAGALVVALWGPLQD SLEHTLRVAIAHYQDDPDLRFLLDQVQLGLRCCGAASYQDWQQNLYFNCSSPGVQACSLP ASCCIDPREDGASVNDQCGFGVLRLDADAAQRVVYLEGCGPPLRRWLRANLAASGGYAIA VVLLQGAELLLAARLLGALAARSGAAYGPGAHGEDRAGPQSPSPGAPPAAKPARG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HPRT (HPRT1) (NM_000194) Human Over-expression Lysate
LY400070 100 µg

HPRT (HPRT1) (NM_000194) Human Over-expression Lysate

Sign In for Pricing
View Details
LLGL1 Human Gene Knockout Kit (CRISPR)
KN417078 1 Kit

LLGL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cdc20 (AR12), 0.2mg/mL
BNUB0672-500 1x 500 µL

Cdc20 (AR12), 0.2mg/mL

Sign In for Pricing
View Details
Rotary Microtome BHTP-203
BHTP-203 1 Unit

Rotary Microtome BHTP-203

Sign In for Pricing
View Details
Mouse Fcgr3 activation kit by CRISPRa
GA201376 1 Kit

Mouse Fcgr3 activation kit by CRISPRa

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD4 Antibody[RM4-4]
AN00417M-01 50 Tests

Elab Fluor® 647 Anti-Mouse CD4 Antibody[RM4-4]

Sign In for Pricing
View Details