Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Gap junction alpha-5 protein (Gja5)

This Recombinant Rat Gap junction alpha-5 protein (Gja5) spans the amino acid sequence from region 2-356.

Product Specifications

Product Name Alternative

Gap junction alpha-5 protein, Connexin-40, Cx40

UniProt

P28234

Expression Region

2-356

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GDWSFLGEFLEEVHKHSTVIGKVWLTVLFIFRMLVLGTAAESSWGDEQADFRCDTIQPGC QNVCYDQAFPISHIRYWVLQIIFVSTPSLVYMGHAMHTVRMQEKQKLREAEKAKEAGGTG TYEYLAEKAELSCWKEVNGKIVLQGTLLNTYVCTILIRTAMEVAFMVGQYLLYGIFLDTL HVCRRSPCPHPVNCYVSRPTEKNVFIVFMMAVAGLSLFLSLAELYHLGWKKIRQRLAKSR QGDKHQLLGPSTSLVQGLTPPPDFNQCLKNSPDEKFFSDFSNNMGSRKNPDPLATEEVPN QEQIPEEGFIHTQYGQKPEQPSGASAGHRFPQGYHSDKRRLSKASSKARSDDLSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Surfactant Protein D, Lectin Domain (SP-D) (MaxLight 650) discontinued
S8402-ML650 100 µL

Surfactant Protein D, Lectin Domain (SP-D) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Restriction Endonucleases: Bpm I
E468 250 units

Restriction Endonucleases: Bpm I

Sign In for Pricing
View Details
Trpm1 (NM_001039104) Mouse Tagged ORF Clone
MG223050 10 µg

Trpm1 (NM_001039104) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
MEA1 Human siRNA Oligo Duplex (Locus ID 4201)
SR302853 1 Kit

MEA1 Human siRNA Oligo Duplex (Locus ID 4201)

Sign In for Pricing
View Details
Anti-PRDM7 Antibody Picoband®, HRP Conjugate
A13923-1-HRP 100 µg/Vial

Anti-PRDM7 Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
Chicken Transmembrane protein 170A (TMEM170A) ELISA Kit
GTR10364525 96 Well

Chicken Transmembrane protein 170A (TMEM170A) ELISA Kit

Sign In for Pricing
View Details