Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Gap junction alpha-5 protein (Gja5)

This Recombinant Rat Gap junction alpha-5 protein (Gja5) spans the amino acid sequence from region 2-356.

Product Specifications

Product Name Alternative

Gap junction alpha-5 protein, Connexin-40, Cx40

UniProt

P28234

Expression Region

2-356

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GDWSFLGEFLEEVHKHSTVIGKVWLTVLFIFRMLVLGTAAESSWGDEQADFRCDTIQPGC QNVCYDQAFPISHIRYWVLQIIFVSTPSLVYMGHAMHTVRMQEKQKLREAEKAKEAGGTG TYEYLAEKAELSCWKEVNGKIVLQGTLLNTYVCTILIRTAMEVAFMVGQYLLYGIFLDTL HVCRRSPCPHPVNCYVSRPTEKNVFIVFMMAVAGLSLFLSLAELYHLGWKKIRQRLAKSR QGDKHQLLGPSTSLVQGLTPPPDFNQCLKNSPDEKFFSDFSNNMGSRKNPDPLATEEVPN QEQIPEEGFIHTQYGQKPEQPSGASAGHRFPQGYHSDKRRLSKASSKARSDDLSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rb1 3'UTR Lenti-reporter-Luc Vector
38567086 1.0 µg

Rb1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
DNAJB4 Antibody
orb419736 100 µL

DNAJB4 Antibody

Sign In for Pricing
View Details
Recombinant Granulysin (GNLY)
TRV-0008989-01 10 µg

Recombinant Granulysin (GNLY)

Sign In for Pricing
View Details
Recombinant Granulysin (GNLY)
TRV-0008989-02 50 µg

Recombinant Granulysin (GNLY)

Sign In for Pricing
View Details
Recombinant Granulysin (GNLY)
TRV-0008989-03 100 µg

Recombinant Granulysin (GNLY)

Sign In for Pricing
View Details
Recombinant Granulysin (GNLY)
TRV-0008989-04 200 µg

Recombinant Granulysin (GNLY)

Sign In for Pricing
View Details