Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gap junction alpha-5 protein (GJA5)

This Recombinant Human Gap junction alpha-5 protein (GJA5) spans the amino acid sequence from region 2-358.

Product Specifications

Product Name Alternative

Gap junction alpha-5 protein, Connexin-40, Cx40

UniProt

P36382

Expression Region

2-358

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GDWSFLGNFLEEVHKHSTVVGKVWLTVLFIFRMLVLGTAAESSWGDEQADFRCDTIQPGC QNVCYDQAFPISHIRYWVLQIIFVSTPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSG SYEYPVAEKAELSCWEEGNGRIALQGTLLNTYVCSILIRTTMEVGFIVGQYFIYGIFLTT LHVCRRSPCPHPVNCYVSRPTEKNVFIVFMLAVAALSLLLSLAELYHLGWKKIRQRFVKP RQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQV RGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDKRRLSKASSKARSDDLSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD64 IGFR1 Antibody PE Conjugated
C04753P 100 µL

CD64 IGFR1 Antibody PE Conjugated

Sign In for Pricing
View Details
Lentiviral human SPRR4 shRNA (UAS) - Lentiviral human SPRR4 shRNA (UAS, iRFP) plasmid
GTR15343423 1 Vial

Lentiviral human SPRR4 shRNA (UAS) - Lentiviral human SPRR4 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Tert-Butyl 2- (methoxymethyl) pyrrolidine-2-carboxylate
GGD26867-01 50 mg

Tert-Butyl 2- (methoxymethyl) pyrrolidine-2-carboxylate

Sign In for Pricing
View Details
Tert-Butyl 2- (methoxymethyl) pyrrolidine-2-carboxylate
GGD26867-02 0.5 g

Tert-Butyl 2- (methoxymethyl) pyrrolidine-2-carboxylate

Sign In for Pricing
View Details
Gibberellin A4
GL8740-25MG 25 mg

Gibberellin A4

Sign In for Pricing
View Details
TRPV6 Adenovirus (Human)
48535051 1.0 mL

TRPV6 Adenovirus (Human)

Sign In for Pricing
View Details