Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gap junction alpha-5 protein (GJA5)

This Recombinant Human Gap junction alpha-5 protein (GJA5) spans the amino acid sequence from region 2-358.

Product Specifications

Product Name Alternative

Gap junction alpha-5 protein, Connexin-40, Cx40

UniProt

P36382

Expression Region

2-358

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GDWSFLGNFLEEVHKHSTVVGKVWLTVLFIFRMLVLGTAAESSWGDEQADFRCDTIQPGC QNVCYDQAFPISHIRYWVLQIIFVSTPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSG SYEYPVAEKAELSCWEEGNGRIALQGTLLNTYVCSILIRTTMEVGFIVGQYFIYGIFLTT LHVCRRSPCPHPVNCYVSRPTEKNVFIVFMLAVAALSLLLSLAELYHLGWKKIRQRFVKP RQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQV RGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDKRRLSKASSKARSDDLSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-C1orf2 antibody
SL9782R-01 50 µL

Rabbit Anti-C1orf2 antibody

Sign In for Pricing
View Details
Rabbit Anti-C1orf2 antibody
SL9782R-02 100 µL

Rabbit Anti-C1orf2 antibody

Sign In for Pricing
View Details
ELK4 (ETS Domain-containing Protein Elk-4, Serum Response Factor Accessory Protein 1, SAP-1, SRF Accessory Protein 1, SAP1) (MaxLight 650)
MBS6221998-01 0.1 mL

ELK4 (ETS Domain-containing Protein Elk-4, Serum Response Factor Accessory Protein 1, SAP-1, SRF Accessory Protein 1, SAP1) (MaxLight 650)

Sign In for Pricing
View Details
ELK4 (ETS Domain-containing Protein Elk-4, Serum Response Factor Accessory Protein 1, SAP-1, SRF Accessory Protein 1, SAP1) (MaxLight 650)
MBS6221998-02 5x 0.1 mL

ELK4 (ETS Domain-containing Protein Elk-4, Serum Response Factor Accessory Protein 1, SAP-1, SRF Accessory Protein 1, SAP1) (MaxLight 650)

Sign In for Pricing
View Details
HMGB1L9 sgRNA CRISPR Lentivector (Human) (Target 3)
K0970404 1.0 µg DNA

HMGB1L9 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
STK24 Antibody
35019-01 50 µL

STK24 Antibody

Sign In for Pricing
View Details