Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus thuringiensis subsp. konkukian UPF0421 protein BT9727_2513 (BT9727_2513)

This Recombinant Bacillus thuringiensis subsp. konkukian UPF0421 protein BT9727_2513 (BT9727_2513) spans the amino acid sequence from region 1-358.

Product Specifications

Product Name Alternative

UPF0421 protein BT9727_2513

UniProt

Q6HHY7

Expression Region

1-358

Origin

Bacillus thuringiensis subsp. konkukian (strain 97-27)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNQVRKWNIIGGRVIKTGIAVFLTVLVCEFFNIPTIFAVITAIVTIEPTATDSIKKGLVR FPASTIGSAYAMTFTFFLGHQALSYALAAMFTIVTCQKLRLHAGTLVATLTAVAMIPITA DHYFTAFLIRLATTSTGIIVSTVVNFFILPPHYVKTISGCTEELFVKTANVMEEWLTALM DGKVIKKETTYNLSKLTVLLHKAVQFVQYEQKDWKYHRHTKKEMRSFLLVQKQLHLLQQI IYHIDNLARAPIETCDWSQNEKEILRRTIHSIISILRNHCEKIDEEHFKLIDELDKQFWT NKNDLAHCKPNQYHHHFSSESIILFEVLSIHDMLEELKQIFEKYEGENQEKSILVDIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UHRF1BP1 Rabbit Polyclonal Antibody
E10G05487 100 µL

UHRF1BP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
B3GALTL Blocking Peptide
33R-2243 0.1 mg

B3GALTL Blocking Peptide

Sign In for Pricing
View Details
MBL (Mannose Binding Lectin)
216808 100 µg

MBL (Mannose Binding Lectin)

Sign In for Pricing
View Details
Rat Parathyroid Hormone Receptor 2 (PTHR2) ELISA Kit
DL-PTHR2-Ra-01 48 Tests

Rat Parathyroid Hormone Receptor 2 (PTHR2) ELISA Kit

Sign In for Pricing
View Details
Rat Parathyroid Hormone Receptor 2 (PTHR2) ELISA Kit
DL-PTHR2-Ra-02 96 Tests

Rat Parathyroid Hormone Receptor 2 (PTHR2) ELISA Kit

Sign In for Pricing
View Details
Monkey Interleukin 8 (IL8) ELISA Kit
RDR-IL8-Si-48Tests 48 Tests

Monkey Interleukin 8 (IL8) ELISA Kit

Sign In for Pricing
View Details