Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus thuringiensis subsp. konkukian UPF0421 protein BT9727_2513 (BT9727_2513)

This Recombinant Bacillus thuringiensis subsp. konkukian UPF0421 protein BT9727_2513 (BT9727_2513) spans the amino acid sequence from region 1-358.

Product Specifications

Product Name Alternative

UPF0421 protein BT9727_2513

UniProt

Q6HHY7

Expression Region

1-358

Origin

Bacillus thuringiensis subsp. konkukian (strain 97-27)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNQVRKWNIIGGRVIKTGIAVFLTVLVCEFFNIPTIFAVITAIVTIEPTATDSIKKGLVR FPASTIGSAYAMTFTFFLGHQALSYALAAMFTIVTCQKLRLHAGTLVATLTAVAMIPITA DHYFTAFLIRLATTSTGIIVSTVVNFFILPPHYVKTISGCTEELFVKTANVMEEWLTALM DGKVIKKETTYNLSKLTVLLHKAVQFVQYEQKDWKYHRHTKKEMRSFLLVQKQLHLLQQI IYHIDNLARAPIETCDWSQNEKEILRRTIHSIISILRNHCEKIDEEHFKLIDELDKQFWT NKNDLAHCKPNQYHHHFSSESIILFEVLSIHDMLEELKQIFEKYEGENQEKSILVDIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Complement Fragment 4d (C4d) ELISA Kit
orb1947896-01 48 Tests

Human Complement Fragment 4d (C4d) ELISA Kit

Sign In for Pricing
View Details
Human Complement Fragment 4d (C4d) ELISA Kit
orb1947896-02 96 Tests

Human Complement Fragment 4d (C4d) ELISA Kit

Sign In for Pricing
View Details
Guinea-pig TF (Tissue Factor) ValidElisa Kit
EK347461 96 Well

Guinea-pig TF (Tissue Factor) ValidElisa Kit

Sign In for Pricing
View Details
V5 Tag (MaxLight 405) discontinued
043700-ML405 100 µL

V5 Tag (MaxLight 405) discontinued

Sign In for Pricing
View Details
3- (3,5-Dimethyl-1H-pyrazol-4-yl) morpholine
SEC69923-01 50 mg

3- (3,5-Dimethyl-1H-pyrazol-4-yl) morpholine

Sign In for Pricing
View Details
3- (3,5-Dimethyl-1H-pyrazol-4-yl) morpholine
SEC69923-02 0.5 g

3- (3,5-Dimethyl-1H-pyrazol-4-yl) morpholine

Sign In for Pricing
View Details