Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Acyl-CoA desaturase (SCD)

This Recombinant Sheep Acyl-CoA desaturase (SCD) spans the amino acid sequence from region 2-359.

Product Specifications

Product Name Alternative

Acyl-CoA desaturase, EC= 1.14.19.1, Delta (9) -desaturase, Delta-9 desaturase, Fatty acid desaturase, Stearoyl-CoA desaturase

UniProt

O62849

Expression Region

2-359

Origin

Ovis aries (Sheep)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

PAHLLQEEISSSYTTTTTITAPPSRVLQNGGGKLEKTPLYLEEDIRPEMRDDIYDPNYQD KEGPKPKLEYVWRNIILMGLLHLGALYGITLIPTCKIYTFLWVLFYYVISALGITAGVHR LWSHRTYKARLPLRVFLIIANTMAFQNDVFEWSRDHRAHHKFSETDADPHNSRRGFFFSH VGWLLVRKHPAVREKGATLDLSDLRAEKLVMFQRRYYKPGVLLLCFILPTLVPWYLWGES FQNSLFFATFLRYAVVLNATWLVNSAAHMYGYRPYDKTINPRENILVSLGAVGEGFHNYH HTFPYDYSASEYRWHINFTTFFIDCMAAIGLAYDRKKVSKAAVLGRMKRTGEESYKSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL
BNC040218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF640R conjugate, 0.1mg/mL
BNC400324-100 1x 100 µL

CD53 (161-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL
BNC550633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL
BNC740633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1620), CF647 conjugate, 0.1mg/mL
BNC471620-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/1620), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vimentin (VM1170), CF568 conjugate, 0.1mg/mL
BNC681170-100 1x 100 µL

Vimentin (VM1170), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details