Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Acyl-CoA desaturase 2 (Scd2)

This Recombinant Mouse Acyl-CoA desaturase 2 (Scd2) spans the amino acid sequence from region 1-358.

Product Specifications

Product Name Alternative

Acyl-CoA desaturase 2, EC= 1.14.19.1, Delta (9) -desaturase 2, Delta-9 desaturase 2, Fatty acid desaturase 2, Stearoyl-CoA desaturase 2

UniProt

P13011

Expression Region

1-358

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPAHILQEISGAYSATTTITAPPSGGQQNGGEKFEKSSHHWGADVRPELKDDLYDPTYQD DEGPPPKLEYVWRNIILMALLHLGALYGITLVPSCKLYTCLFAYLYYVISALGITAGAHR LWSHRTYKARLPLRLFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSH VGWLLVRKHPAVKEKGGKLDMSDLKAEKLVMFQRRYYKPGLLLMCFVLPTLVPWYCWGET FVNSLCVSTFLRYAVVLNATWLVNSAAHLYGYRPYDKNISSRENILVSMGAVGEGFHNYH HAFPYDYSASEYRWHINFTTFFIDCMALLGLAYDRKRVSRAAVLARIKRTGDGSCKSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD95 (B-R18), CF594 conjugate, 0.1mg/mL
BNC940305-100 1x 100 µL

CD95 (B-R18), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF594 conjugate, 0.1mg/mL
BNC942853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), Biotin conjugate, 0.1mg/mL
BNCB0391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Moesin (rMSN/492), CF405S conjugate, 0.1mg/mL
BNC042307-500 1x 500 µL

Moesin (rMSN/492), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (LAMP3/968), CF405M conjugate, 0.1mg/mL
BNC050968-500 1x 500 µL

CD63 (LAMP3/968), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18/836), CF647 conjugate, 0.1mg/mL
BNC470836-500 1x 500 µL

Cytokeratin 18 (KRT18/836), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details