Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ashbya gossypii Palmitoyltransferase PFA5 (PFA5)

This Recombinant Ashbya gossypii Palmitoyltransferase PFA5 (PFA5) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

Palmitoyltransferase PFA5, EC= 2.3.1.-, Protein fatty acyltransferase 5

UniProt

Q75D19

Expression Region

1-359

Origin

Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWQCKNKSRWWYSLVPILCICIMCYGAIAYSYSFCYVEVWTHLGMKAAAIGMTCLHLIIV ILLWIIWAQIIMMGPGRQPRVAPFMILPEMADAGERAKEGAATSVLPPDVYQCDTQGYPV WCSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFNQFLMCFLMHALIIF VSVVSLQRRIASSARMRGEREDPNVLVVLSLSCLVLLMVGALFISFLNYMANNQTTIEKL DTPKRQPRTMCFCVYNPADQYRYVVKSLPHENWNMWDKGSAYANYKDFLGSSIWRWFIPI GSNIPEFQTSAWEDDYNAILGPYKEELGSHYRDILMQRIEQGKYVTRLRVYGDKFREGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF514 conjugate, 0.1mg/mL
BNC140017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF514 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF740 conjugate, 0.1mg/mL
BNC740012-500 1x 500 µL

Tyrosinase (T311), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF405S conjugate, 0.1mg/mL
BNC041045-100 1x 100 µL

CD16 (C16/1045), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF514 conjugate, 0.1mg/mL
BNC140146-100 1x 100 µL

CD10 (CB-CALLA), CF514 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF405S conjugate, 0.1mg/mL
BNC042171-500 1x 500 µL

Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF640R conjugate, 0.1mg/mL
BNC400322-500 1x 500 µL

CD3e (RIV9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details