Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Flagellar biosynthetic protein flhB (flhB)

This Recombinant Bacillus subtilis Flagellar biosynthetic protein flhB (flhB) spans the amino acid sequence from region 1-360.

Product Specifications

Product Name Alternative

Flagellar biosynthetic protein flhB

UniProt

P35538

Expression Region

1-360

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLRVDLQFFAGEKTEKATPKKRKDTRKKGQVAKSSDVNTAVSLLVIFLSLIAIGPYMRD RLLSFIETFYTESLTMKLSESNVHTLFVSLLKDMGMILAPILLVALVAGVVSNYMQVGFL FSAEVIQPKLEKLDPIKGFKRIYSMRAIVELIKSILKIVVVGFAAFAVLWLHYGEILRLP LLTPEEALSFVSKLTLWMGLSGAGALLILAGLDYLYQRFDYEKNIKMSKQDIKDEYKKSE GDPIIKSKIKQRQREMAMRRMMQEVPKADVIITNPTHYAIALKYDEEKMDAPYIVAKGVD HLALKIRKIAKEHDVMMVENRPLARALYDQVEIDQAVPEEFFKVLAEILAYVYKTKQKVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIC W006-Tri 025-PE-SHEET/13 Electrical & Equipment Safety Signs & Labels (Adhesive)
827203 13 Sheet (13 Panel (s) x 1 Sheet)

PIC W006-Tri 025-PE-SHEET/13 Electrical & Equipment Safety Signs & Labels (Adhesive)

Sign In for Pricing
View Details
TAS1R2 Protein Vector (Mouse) (pPB-C-His)
PV236374 500 ng

TAS1R2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
MIRacle™ hsa-miR-3675-5p miRNA Agomir/Antagomir
AM0416 2 OD, 4 OD, 50 OD

MIRacle™ hsa-miR-3675-5p miRNA Agomir/Antagomir

Sign In for Pricing
View Details
Sphingomyelin Synthase 1 (SGMS1) Human qPCR Primer Pair (NM_147156)
HP217525 200 Reactions

Sphingomyelin Synthase 1 (SGMS1) Human qPCR Primer Pair (NM_147156)

Sign In for Pricing
View Details
Human Monoclonal FoxP2 Antibody (RAB-S249) - F(ab) - Azide and BSA Free
NBP3-20154-0.025mg 0.025 mg

Human Monoclonal FoxP2 Antibody (RAB-S249) - F(ab) - Azide and BSA Free

Sign In for Pricing
View Details
PSCA Double Nickase Plasmid (m)
sc-428326-NIC 20 µg

PSCA Double Nickase Plasmid (m)

Sign In for Pricing
View Details