Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Flagellar biosynthetic protein flhB (flhB)

This Recombinant Bacillus subtilis Flagellar biosynthetic protein flhB (flhB) spans the amino acid sequence from region 1-360.

Product Specifications

Product Name Alternative

Flagellar biosynthetic protein flhB

UniProt

P35538

Expression Region

1-360

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLRVDLQFFAGEKTEKATPKKRKDTRKKGQVAKSSDVNTAVSLLVIFLSLIAIGPYMRD RLLSFIETFYTESLTMKLSESNVHTLFVSLLKDMGMILAPILLVALVAGVVSNYMQVGFL FSAEVIQPKLEKLDPIKGFKRIYSMRAIVELIKSILKIVVVGFAAFAVLWLHYGEILRLP LLTPEEALSFVSKLTLWMGLSGAGALLILAGLDYLYQRFDYEKNIKMSKQDIKDEYKKSE GDPIIKSKIKQRQREMAMRRMMQEVPKADVIITNPTHYAIALKYDEEKMDAPYIVAKGVD HLALKIRKIAKEHDVMMVENRPLARALYDQVEIDQAVPEEFFKVLAEILAYVYKTKQKVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nprl3 siRNA Oligos set (Mouse)
32101174 3x 5 nmol

Nprl3 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Nanog Protein Vector (Mouse) (pPM-C-His)
PV204057 500 ng

Nanog Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Anti-Caspase-3(P17)/CASP3 Antibody
MBS1753314-01 0.1 mg

Anti-Caspase-3(P17)/CASP3 Antibody

Sign In for Pricing
View Details
Anti-Caspase-3(P17)/CASP3 Antibody
MBS1753314-02 5x 0.1 mg

Anti-Caspase-3(P17)/CASP3 Antibody

Sign In for Pricing
View Details
CD137L Double Nickase Plasmid (m2)
sc-423455-NIC-2 20 µg

CD137L Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
ACAP2 (Arf-GAP with coiled-coil, ANK Repeat and PH Domain-Containing Protein 2, Centaurin-beta-2, Cnt-b2, ACAP2, CENTB2, KIAA0041) (Biotin)
MBS6453865-01 0.2 mL

ACAP2 (Arf-GAP with coiled-coil, ANK Repeat and PH Domain-Containing Protein 2, Centaurin-beta-2, Cnt-b2, ACAP2, CENTB2, KIAA0041) (Biotin)

Sign In for Pricing
View Details