Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Large-conductance mechanosensitive channel MscMJLR (MJ1143)

This Recombinant Methanocaldococcus jannaschii Large-conductance mechanosensitive channel MscMJLR (MJ1143) spans the amino acid sequence from region 1-361.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel MscMJLR

UniProt

Q58543

Expression Region

1-361

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTITQMISEILMHNTVYNYILSLISIILFIVIGKYANALIERLADKLHKKSGIELDELLI RALSLPVAIAIILSGFYFGVNFLYLLPSLKTAVNEGILTAFILCVVVFFDRFLNELVERY LALTISKKTKKDVDDQIVVLTKKLVRLVVWVVGLLLILSNLGYDIKTLLAGLGIGGLAVA LASQNLVSNLIAGLIILTDKPFKIGNWITFSGGSGIVEDIGIRSTKIRATDNSIIVVPNS KLIDEIIQNVPSKNKWKVSTTIGVTYNTPVEKIRKAEEIIKNILLEHPNVEDEPITVYFK EFGDWSLNIQVVYYIKNSRYNGYQKYISTINEVNLKIKEEFDRKGIEFAFPTYTLYLKRD D

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat coagulation factor VIII related antigen (FVIII-Ag) ELISA Kit
MBS266961-01 48 Well

Rat coagulation factor VIII related antigen (FVIII-Ag) ELISA Kit

Sign In for Pricing
View Details
Rat coagulation factor VIII related antigen (FVIII-Ag) ELISA Kit
MBS266961-02 96 Well

Rat coagulation factor VIII related antigen (FVIII-Ag) ELISA Kit

Sign In for Pricing
View Details
Rat coagulation factor VIII related antigen (FVIII-Ag) ELISA Kit
MBS266961-03 5x 96 Well

Rat coagulation factor VIII related antigen (FVIII-Ag) ELISA Kit

Sign In for Pricing
View Details
Rat coagulation factor VIII related antigen (FVIII-Ag) ELISA Kit
MBS266961-04 10x 96 Well

Rat coagulation factor VIII related antigen (FVIII-Ag) ELISA Kit

Sign In for Pricing
View Details
FBXW10 (NM_001267586) Human Untagged Clone
SC332862 10 µg

FBXW10 (NM_001267586) Human Untagged Clone

Sign In for Pricing
View Details
MAEA (NM_001017405) Human Untagged Clone
SC319475 10 µg

MAEA (NM_001017405) Human Untagged Clone

Sign In for Pricing
View Details