Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Trans-2,3-enoyl-CoA reductase-like (Tecrl)

This Recombinant Mouse Trans-2,3-enoyl-CoA reductase-like (Tecrl) spans the amino acid sequence from region 1-361.

Product Specifications

Product Name Alternative

Trans-2,3-enoyl-CoA reductase-like, EC= 1.3.1.-, Steroid 5-alpha-reductase 2-like 2 protein

UniProt

Q8BFZ1

Expression Region

1-361

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFKRHKSLERKRELLFQGLPQSTMKNNARNFHSLSQLVLSAGPLKTTTAVKHSKTTHFEI EILDAHTRKQICIVDKVTQTSTIHDVKQKFHKACPKWYPSRIGLQLEYGGPYLRDYITVQ SVAASSIITLYFTDLGQQVGWTTVFLAEYSGPLLIYLLFYLRSSYIYDVKESTRWPRHPV VHLAFFCHCIHYIRLLLETLFVHKVSTGHSPMKNLIKGCAFYWGFTSWMAYYINHPRYTP PSFGNRQVIVSAINFLFCEAGNHFINTVLAHPNHTGSNACFPSPNYNPFTWLFFLVSCPN YTYEIGSWISFTVMTQTLPVGIFTILMTIQMSLWARKKHKIYRKKFNSYVHRKSAIIPLI L

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL
BNC470146-100 1x 100 µL

CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF568 conjugate, 0.1mg/mL
BNC680305-100 1x 100 µL

CD95 (B-R18), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF488A conjugate, 0.1mg/mL
BNC881429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF647 conjugate, 0.1mg/mL
BNC471035-100 1x 100 µL

CD8 (C8/1035), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (8C8), CF594 conjugate, 0.1mg/mL
BNC940005-100 1x 100 µL

Bcl-2 (8C8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (rKRT8.18/1346), CF488A conjugate, 0.1mg/mL
BNC882298-500 1x 500 µL

Cytokeratin 8/18 (rKRT8.18/1346), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details