Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Innexin-17 (inx-17)

This Recombinant Innexin-17 (inx-17) spans the amino acid sequence from region 1-362.

Product Specifications

Product Name Alternative

Innexin-17, Gap junction innexin, Protein opu-17

UniProt

O61788

Expression Region

1-362

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKIDTGFYSKTITPTYDSDAIDRLRYYFTVFLLTSSAFFIMAKQYVGQSIQCWAPKQFKG GWEEYAESYCLIENTYYVHMNNSNLPGPAIRENKELKYYQWVPFILFGLAVVIYIPRVIW NALQSLIGINISIVTSNLRKVAKSGFTSENPDIEKKKKEMQCKKKATSRQVDGEFWGSRL TTCILATKFLATILIFISMGFLDYFMGLGPMYGWTITKDILQGRQWQESGSFPRVTFCDF QVRELGYVNNWSLQCVLMVNMFNEKLFIALWWWYALLAILSIFDIFRVLFRFTIHHQISF ITRILACTGDSAISATEVGEFNRKVLRIDGINLTHLVYANATIFEAADFVRPMWEQFKEN QN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-28A/IFN-lambda 2, Tag Free
HA210956-01 Inquire

Human IL-28A/IFN-lambda 2, Tag Free

Sign In for Pricing
View Details
Human IL-28A/IFN-lambda 2, Tag Free
HA210956-02 50 µg

Human IL-28A/IFN-lambda 2, Tag Free

Sign In for Pricing
View Details
Human IL-28A/IFN-lambda 2, Tag Free
HA210956-03 100 µg

Human IL-28A/IFN-lambda 2, Tag Free

Sign In for Pricing
View Details
CD28 (C28/74), CF647 conjugate, 0.1mg/mL
BNC470074-500 1x 500 µL

CD28 (C28/74), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse CD47 Protein (His Tag)
PKSM041042-01 10 µg

Recombinant Mouse CD47 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse CD47 Protein (His Tag)
PKSM041042-02 50 µg

Recombinant Mouse CD47 Protein (His Tag)

Sign In for Pricing
View Details