Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Photoreceptor outer segment membrane glycoprotein 2

This Recombinant Chicken Photoreceptor outer segment membrane glycoprotein 2 spans the amino acid sequence from region 1-364.

Product Specifications

Product Name Alternative

Photoreceptor outer segment membrane glycoprotein 2, CRDS2

UniProt

O42282

Expression Region

1-364

Origin

Gallus gallus (Chicken)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTVLKVKFTKTKRDKLAQILWILNWVSVVSGIILFSLGLFLKIEIKKRNEVMAKGDINSV PNMLISVGVIACVVNFLGGKICYDCSDANKFSRWKLIMLPYIICTFCFTFCILLGALMCY TMRNELEESLYLGLRDAIKFYKDTDIPGRCFLKKTVDMLQIGFQCCGNNGFRDWFEVQWV SARYLNMASKEVMDRFKSNVDGKFLVDGVPFSCCNPSSPRPCIQYHLTNNSAHYNYDFLT EELNIWVKGCREALLEYYTAIMRSIGIAALLIWLFELSVLIGVRYLQTAMKNVLLQGDLQ GESDGWLLENSFVETAKYNINIIKNLGKANQISTVSGMNDPNINVQNTNCGKSNVTAKSI PAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Motilin (mLN) Human Gene Knockout Kit (CRISPR)
KN421639 1 Kit

Motilin (mLN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Thyroid gland
CR559331 5 µg

Tissue Total RNA, Thyroid gland

Sign In for Pricing
View Details
C1QB (NM_000491) Human Recombinant Protein
TP303821 20 µg

C1QB (NM_000491) Human Recombinant Protein

Sign In for Pricing
View Details
Tienilic Acid
TRC-T438750-5MG 5 mg

Tienilic Acid

Sign In for Pricing
View Details
Recombinant Mouse LYPD3 Protein (His Tag)
PKSM040620 100 µg

Recombinant Mouse LYPD3 Protein (His Tag)

Sign In for Pricing
View Details
Desmin (Muscle Cell Marker) (DES/1711), 1mg/mL
BNUM1711-50 1x 50 µL

Desmin (Muscle Cell Marker) (DES/1711), 1mg/mL

Sign In for Pricing
View Details