Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Rhomboid domain-containing protein 2 (RHBDD2)

This Recombinant Human Rhomboid domain-containing protein 2 (RHBDD2) spans the amino acid sequence from region 1-364.

Product Specifications

Product Name Alternative

Rhomboid domain-containing protein 2

UniProt

Q6NTF9

Expression Region

1-364

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAASGPGCRSWCLCPEVPSATFFTALLSLLVSGPRLFLLQQPLAPSGLTLKSEALRNWQV YRLVTYIFVYENPISLLCGAIIIWRFAGNFERTVGTVRHCFFTVIFAIFSAIIFLSFEAV SSLSKLGEVEDARGFTPVAFAMLGVTTVRSRMRRALVFGMVVPSVLVPWLLLGASWLIPQ TSFLSNVCGLSIGLAYGLTYCYSIDLSERVALKLDQTFPFSLMRRISVFKYVSGSSAERR AAQSRKLNPVPGSYPTQSCHPHLSPSHPVSQTQHASGQKLASWPSCTPGHMPTLPPYQPA SGLCYVQNHFGPNPTSSSVYPASAGTSLGIQPPTPVNSPGTVYSGALGTPGAAGSKESSR VPMP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MMS2 (UBE2V2) (NM_003350) AAV Particle
RC204996A1V 250 µL

Human MMS2 (UBE2V2) (NM_003350) AAV Particle

Sign In for Pricing
View Details
PGC1 beta (PPARGC1B) (NM_001172698) Human Tagged ORF Clone Lentiviral Particle
RC230600L4V 200 µL

PGC1 beta (PPARGC1B) (NM_001172698) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
OR52I2 Antibody - C-terminal region
OAAB08074-400UL 400 µL

OR52I2 Antibody - C-terminal region

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi B UPF0352 protein yejL (yejL)
MBS1150765-01 0.02 mg (E-Coli)

Recombinant Salmonella paratyphi B UPF0352 protein yejL (yejL)

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi B UPF0352 protein yejL (yejL)
MBS1150765-02 0.1 mg (E-Coli)

Recombinant Salmonella paratyphi B UPF0352 protein yejL (yejL)

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi B UPF0352 protein yejL (yejL)
MBS1150765-03 0.02 mg (Yeast)

Recombinant Salmonella paratyphi B UPF0352 protein yejL (yejL)

Sign In for Pricing
View Details