Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gap junction delta-4 protein (Gjd4)

This Recombinant Mouse Gap junction delta-4 protein (Gjd4) spans the amino acid sequence from region 1-364.

Product Specifications

Product Name Alternative

Gap junction delta-4 protein, Connexin-39, Cx39

UniProt

Q8BSD4

Expression Region

1-364

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKLNLLGFLIITLNCNVTIMGMIWLIVEVLLRMLVVVLAGSPIYEDEQERFICNTLQPG CANVCYDLFSPVSPLRFWLVQSLALLLPSVVFGTYTLHRGAKLAAVGGACRPQVPDLSTA YLVHLLLRMLLEAGLAFLHYFLFGFSVPARVSCSHVPCSGAVDCYVSRPTEKSLLILFFW AVSALSFLLSLADLLWILPRRKTLRTTQWVNGEARPVCEVPAPPPCLLQNPQGYLSQGQV DQEDRQEEQVVPEFPCMWTAGQSDNSNVGQACVSGLLEHSDQDASEATSSAGDRLTVAHT AHELRFHRETSLDLGGKNTQADELSLATQSHLARHSSASKPQAPCRLTTSGSAPHLRTKK SEWV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Fumarylacetoacetase (FAH) ELISA Kit
MBS9361186-01 48 Well

Hamster Fumarylacetoacetase (FAH) ELISA Kit

Sign In for Pricing
View Details
Hamster Fumarylacetoacetase (FAH) ELISA Kit
MBS9361186-02 96 Well

Hamster Fumarylacetoacetase (FAH) ELISA Kit

Sign In for Pricing
View Details
Hamster Fumarylacetoacetase (FAH) ELISA Kit
MBS9361186-03 5x 96 Well

Hamster Fumarylacetoacetase (FAH) ELISA Kit

Sign In for Pricing
View Details
Hamster Fumarylacetoacetase (FAH) ELISA Kit
MBS9361186-04 10x 96 Well

Hamster Fumarylacetoacetase (FAH) ELISA Kit

Sign In for Pricing
View Details
Zdhhc8 (NM_001039021) Rat Tagged Lenti ORF Clone
RR205221L3 10 µg

Zdhhc8 (NM_001039021) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CDK12 Antibody, FITC conjugated
CSB-PA882147LC01HU-01 50 µg

CDK12 Antibody, FITC conjugated

Sign In for Pricing
View Details