Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gap junction delta-4 protein (Gjd4)

This Recombinant Mouse Gap junction delta-4 protein (Gjd4) spans the amino acid sequence from region 1-364.

Product Specifications

Product Name Alternative

Gap junction delta-4 protein, Connexin-39, Cx39

UniProt

Q8BSD4

Expression Region

1-364

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKLNLLGFLIITLNCNVTIMGMIWLIVEVLLRMLVVVLAGSPIYEDEQERFICNTLQPG CANVCYDLFSPVSPLRFWLVQSLALLLPSVVFGTYTLHRGAKLAAVGGACRPQVPDLSTA YLVHLLLRMLLEAGLAFLHYFLFGFSVPARVSCSHVPCSGAVDCYVSRPTEKSLLILFFW AVSALSFLLSLADLLWILPRRKTLRTTQWVNGEARPVCEVPAPPPCLLQNPQGYLSQGQV DQEDRQEEQVVPEFPCMWTAGQSDNSNVGQACVSGLLEHSDQDASEATSSAGDRLTVAHT AHELRFHRETSLDLGGKNTQADELSLATQSHLARHSSASKPQAPCRLTTSGSAPHLRTKK SEWV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human G-Elongation Factor, Mitochondrial 2 (GFM2) Protein
abx650961-01 10 µg

Human G-Elongation Factor, Mitochondrial 2 (GFM2) Protein

Sign In for Pricing
View Details
Human G-Elongation Factor, Mitochondrial 2 (GFM2) Protein
abx650961-02 50 µg

Human G-Elongation Factor, Mitochondrial 2 (GFM2) Protein

Sign In for Pricing
View Details
Human G-Elongation Factor, Mitochondrial 2 (GFM2) Protein
abx650961-03 100 µg

Human G-Elongation Factor, Mitochondrial 2 (GFM2) Protein

Sign In for Pricing
View Details
Human G-Elongation Factor, Mitochondrial 2 (GFM2) Protein
abx650961-04 200 µg

Human G-Elongation Factor, Mitochondrial 2 (GFM2) Protein

Sign In for Pricing
View Details
Human G-Elongation Factor, Mitochondrial 2 (GFM2) Protein
abx650961-05 500 µg

Human G-Elongation Factor, Mitochondrial 2 (GFM2) Protein

Sign In for Pricing
View Details
MYLK2 Lentiviral Activation Particles (h)
sc-406143-LAC 200 µL

MYLK2 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details