Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Membrane protein insertase YidC (yidC)

This Recombinant Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 1-366.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

P65626

Expression Region

1-366

Origin

Mycobacterium tuberculosis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLFDFFSLDFIYYPVSWIMWVWYRLFAFVLGPSNFFAWALSVMFLVFTLRALLYKPFV RQIRTTRQMQELQPQIKALQKKYGKDRQRMALEMQKLQREHGFNPILGCLPMLAQIPVFL GLYHVLRSFNRTTGGFGQPHLSVIENRLTGNYVFSPVDVGHFLDANLFGAPIGAYMTQRS GLDAFVDFSRPALIAVGVPVMILAGIATYFNSRASIARQSAEAAANPQTAMMNKLALYVF PLGVVVGGPFLPLAIILYWFSNNIWTFGQQHYVFGMIEKEEEAKKQEAVRRRAANAPAPG AKPKRSPKTAPATNAAAPTEAGDTDDGAESDASTERPADTSNPARRNSGPSARTPRPGVR PKKRKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYFIP1 3'UTR Lenti-reporter-Luc Vector
17298081 1.0 µg

CYFIP1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
RBMS1 (NM_016839) Human Tagged Lenti ORF Clone
RC221296L4 10 µg

RBMS1 (NM_016839) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Interleukin 6 (IL6) BioAssayTM ECL Kit (Canine)
366216 96 Tests

Interleukin 6 (IL6) BioAssayTM ECL Kit (Canine)

Sign In for Pricing
View Details
Anti-African clawed frog Hic2 Antibody (Biotine Conjugate)
DZ10161-Biotin 200 µL/Vial

Anti-African clawed frog Hic2 Antibody (Biotine Conjugate)

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. japonica (Rice) BC1L7 Polyclonal Antibody
MBS7198969 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) BC1L7 Polyclonal Antibody

Sign In for Pricing
View Details
Dihydroxyacetone kinase 2 homolog (S. cerevisiae)
313512 100 µL

Dihydroxyacetone kinase 2 homolog (S. cerevisiae)

Sign In for Pricing
View Details