Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Membrane protein insertase YidC (yidC)

This Recombinant Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 1-366.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

P65626

Expression Region

1-366

Origin

Mycobacterium tuberculosis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLFDFFSLDFIYYPVSWIMWVWYRLFAFVLGPSNFFAWALSVMFLVFTLRALLYKPFV RQIRTTRQMQELQPQIKALQKKYGKDRQRMALEMQKLQREHGFNPILGCLPMLAQIPVFL GLYHVLRSFNRTTGGFGQPHLSVIENRLTGNYVFSPVDVGHFLDANLFGAPIGAYMTQRS GLDAFVDFSRPALIAVGVPVMILAGIATYFNSRASIARQSAEAAANPQTAMMNKLALYVF PLGVVVGGPFLPLAIILYWFSNNIWTFGQQHYVFGMIEKEEEAKKQEAVRRRAANAPAPG AKPKRSPKTAPATNAAAPTEAGDTDDGAESDASTERPADTSNPARRNSGPSARTPRPGVR PKKRKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FK506 Binding Protein 5 (FKBP5) ELISA Kit
DLR-FKBP5-Hu-96T 96 Tests

Human FK506 Binding Protein 5 (FKBP5) ELISA Kit

Sign In for Pricing
View Details
ADAM29 Human Over-expression Lysate
orb1361217 20 µg

ADAM29 Human Over-expression Lysate

Sign In for Pricing
View Details
GAL3ST1 (NM_004861) Human Tagged ORF Clone
RC205706 10 µg

GAL3ST1 (NM_004861) Human Tagged ORF Clone

Sign In for Pricing
View Details
L-Tyrosine disodium salt hydrate
T9950-01 5 g

L-Tyrosine disodium salt hydrate

Sign In for Pricing
View Details
L-Tyrosine disodium salt hydrate
T9950-02 25 g

L-Tyrosine disodium salt hydrate

Sign In for Pricing
View Details
L-Tyrosine disodium salt hydrate
T9950-03 100 g

L-Tyrosine disodium salt hydrate

Sign In for Pricing
View Details