Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Palmitoyltransferase ZDHHC2 (Zdhhc2)

This Recombinant Rat Palmitoyltransferase ZDHHC2 (Zdhhc2) spans the amino acid sequence from region 1-366.

Product Specifications

Product Name Alternative

Palmitoyltransferase ZDHHC2, EC= 2.3.1.-, Zinc finger DHHC domain-containing protein 2, DHHC-2

UniProt

Q9JKR5

Expression Region

1-366

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPSGPGGVRRRCRRVLYWIPVVFISLLLGWSYYAYAIQLCIVSMENIGEQVVCLMAYHL LFAMFVWSYWKTIFTLPMNPSKEFHLSYAEKELLEREPRGEAHQEVLRRAAKDLPIYTRT MSGAIRYCDRCRLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSLL YCLFIAATDLQYFIRFWTNGLPDTQAKFHIMFLFFAAAMFSVSLSSLFGYHCWLVSKNKS TLEAFRNPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYWLLPIFSSQGDGCSFPTCLVNQD PEQPSTPAGLNSTAKNPENHQFPAKPLRESQSHLLTDSQTWTENSSNSGRCKAGMSNPAL TMENET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (SX53G8), CF488A conjugate, 0.1mg/mL
BNC880669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF647 conjugate, 0.1mg/mL
BNC470175-500 1x 500 µL

CD46 (122.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL
BNC940003-500 1x 500 µL

CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL
BNC681003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL
BNC680225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (DCS-60.2), CF647 conjugate, 0.1mg/mL
BNC470822-500 1x 500 µL

P21 / WAF1 (DCS-60.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details