Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein tlpB (tlpB)

This Recombinant Protein tlpB (tlpB) spans the amino acid sequence from region 1-367.

Product Specifications

Product Name Alternative

Protein tlpB

UniProt

Q45FN5

Expression Region

1-367

Origin

Flavobacterium psychrophilum

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKVKSSYLPYTIRILISFLFIISAIAKMYPSPYFAISTFEVKQLYPLGFSEIIAPWFSR ILIGIELALGILILQNNFLRKLIIPITILLLAVFVGHLSYVTFLSGGNTGNCGCFGELIP MTPIQAIIKNIIAIFLLVYLFFLLSKTNDKNNFYVVIGITLATIISLFLLAPIKKNTNDF TISPIENTLIDSTKNEIIAPILKDSVITTVKVDSVKKAIPTKIEEVISTTEPTKHKSGYA KLFPKIDTGRKTLCFFVPGCDHCRKAAKELTELKQKNANFPEILIIFMNEEVDLIPDFFK ETGAEYPYKIIEIIPFWNALGTGKDTPGVKYIWNGNTYKYYNGITDNKFNPIDYQALINK PFSELKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prostate Specific Antigen (KLK3) Mouse Monoclonal Antibody [Clone ID: OTI1A1]
CF808354 100 µg

Prostate Specific Antigen (KLK3) Mouse Monoclonal Antibody [Clone ID: OTI1A1]

Sign In for Pricing
View Details
N-Nitroso Cariprazine
TRC-N842910-25MG 25 mg

N-Nitroso Cariprazine

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS638334 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
CEP290 Rabbit Polyclonal Antibody
AP21146PU-N 100 µg

CEP290 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Spink10 Mouse Gene Knockout Kit (CRISPR)
KN516611 1 Kit

Spink10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Matrin 3 (MATR3) Human Knockdown Lysate
LY300371 100 µg

Matrin 3 (MATR3) Human Knockdown Lysate

Sign In for Pricing
View Details