Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlamydia muridarum Uncharacterized protein TC_0273 (TC_0273)

This Recombinant Chlamydia muridarum Uncharacterized protein TC_0273 (TC_0273) spans the amino acid sequence from region 1-367.

Product Specifications

Product Name Alternative

Uncharacterized protein TC_0273

UniProt

Q9PL35

Expression Region

1-367

Origin

Chlamydia muridarum (strain MoPn / Nigg)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVKIMAPITPTTSPQVKGLLSRFLTAPDRHPKLRYVYDISLIAISILCIVSIILWTQGSG LALFAIAPALAIGALGVTLLVSDLAESPKSKEVADTVAAVSLPFILTGTAAGLMFSAIAV GGGAVILANPLFLMGSMTLGFALMSLHKVTYQYLSNRSQWQKQNKIKQIESAAWENKLPK ESKESSLQTSVRYSSLARKDKTRRNKPGMPNKGSQVPASIANTERSLRSEEVLHSQSLLR QKELFPNTSNIKKELPNTKSILHTPLNRRSPSGSDSDDVYYTPRAGLSSAETSALGDISG ISSSSTSSKTSTPKAKRRVVRSSRSERNARHHRNKEDHRQNQEESSDDEDSSPLPSPRRK KYRSRPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C20orf79 (SCP2D1) Mouse Monoclonal Antibody [Clone ID: OTI4D10]
CF812873 100 µg

C20orf79 (SCP2D1) Mouse Monoclonal Antibody [Clone ID: OTI4D10]

Sign In for Pricing
View Details
GALT Recombinant Rabbit Monoclonal Antibody [PSH02-87]
HA721875 100 µL

GALT Recombinant Rabbit Monoclonal Antibody [PSH02-87]

Sign In for Pricing
View Details
AREL1 Antibody
OC-251-01 50 μL

AREL1 Antibody

Sign In for Pricing
View Details
AREL1 Antibody
OC-251-02 100 µL

AREL1 Antibody

Sign In for Pricing
View Details
AREL1 Antibody
OC-251-03 1 mL

AREL1 Antibody

Sign In for Pricing
View Details
SnoN (SKIL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F6]
TA800171BM 100 µL

SnoN (SKIL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F6]

Sign In for Pricing
View Details