Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlamydia muridarum Uncharacterized protein TC_0273 (TC_0273)

This Recombinant Chlamydia muridarum Uncharacterized protein TC_0273 (TC_0273) spans the amino acid sequence from region 1-367.

Product Specifications

Product Name Alternative

Uncharacterized protein TC_0273

UniProt

Q9PL35

Expression Region

1-367

Origin

Chlamydia muridarum (strain MoPn / Nigg)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVKIMAPITPTTSPQVKGLLSRFLTAPDRHPKLRYVYDISLIAISILCIVSIILWTQGSG LALFAIAPALAIGALGVTLLVSDLAESPKSKEVADTVAAVSLPFILTGTAAGLMFSAIAV GGGAVILANPLFLMGSMTLGFALMSLHKVTYQYLSNRSQWQKQNKIKQIESAAWENKLPK ESKESSLQTSVRYSSLARKDKTRRNKPGMPNKGSQVPASIANTERSLRSEEVLHSQSLLR QKELFPNTSNIKKELPNTKSILHTPLNRRSPSGSDSDDVYYTPRAGLSSAETSALGDISG ISSSSTSSKTSTPKAKRRVVRSSRSERNARHHRNKEDHRQNQEESSDDEDSSPLPSPRRK KYRSRPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICAM1 Recombinant Rabbit Monoclonal Antibody [JE77-69]
HA722417 100 µL

ICAM1 Recombinant Rabbit Monoclonal Antibody [JE77-69]

Sign In for Pricing
View Details
PLCXD3 (NM_001005473) Human Recombinant Protein
TP319570 20 µg

PLCXD3 (NM_001005473) Human Recombinant Protein

Sign In for Pricing
View Details
Serum Amyloid A (SAA/2868R), CF640R conjugate, 0.1mg/mL
BNC402868-500 1x 500 µL

Serum Amyloid A (SAA/2868R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (rNGFR/1965), CF568 conjugate, 0.1mg/mL
BNC682551-500 1x 500 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (rNGFR/1965), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human NLRX1 activation kit by CRISPRa
GA112536 1 Kit

Human NLRX1 activation kit by CRISPRa

Sign In for Pricing
View Details
Replication Protein A2 (RPA2) (RPA2/3140R), CF647 conjugate, 0.1mg/mL
BNC473140-100 1x 100 µL

Replication Protein A2 (RPA2) (RPA2/3140R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details