Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlamydia muridarum Uncharacterized protein TC_0273 (TC_0273)

This Recombinant Chlamydia muridarum Uncharacterized protein TC_0273 (TC_0273) spans the amino acid sequence from region 1-367.

Product Specifications

Product Name Alternative

Uncharacterized protein TC_0273

UniProt

Q9PL35

Expression Region

1-367

Origin

Chlamydia muridarum (strain MoPn / Nigg)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVKIMAPITPTTSPQVKGLLSRFLTAPDRHPKLRYVYDISLIAISILCIVSIILWTQGSG LALFAIAPALAIGALGVTLLVSDLAESPKSKEVADTVAAVSLPFILTGTAAGLMFSAIAV GGGAVILANPLFLMGSMTLGFALMSLHKVTYQYLSNRSQWQKQNKIKQIESAAWENKLPK ESKESSLQTSVRYSSLARKDKTRRNKPGMPNKGSQVPASIANTERSLRSEEVLHSQSLLR QKELFPNTSNIKKELPNTKSILHTPLNRRSPSGSDSDDVYYTPRAGLSSAETSALGDISG ISSSSTSSKTSTPKAKRRVVRSSRSERNARHHRNKEDHRQNQEESSDDEDSSPLPSPRRK KYRSRPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DiD Perchlorate *UltraPure Grade*
22034-AAT 25 mg

DiD Perchlorate *UltraPure Grade*

Sign In for Pricing
View Details
TSPAN7 Antibody
KC-26858-01 50 μL

TSPAN7 Antibody

Sign In for Pricing
View Details
TSPAN7 Antibody
KC-26858-02 100 µL

TSPAN7 Antibody

Sign In for Pricing
View Details
TSPAN7 Antibody
KC-26858-03 1 mL

TSPAN7 Antibody

Sign In for Pricing
View Details
Mini Sample Mouse Gas6 (Growth Arrest Specific Protein 6) ELISA Kit
E-MSEL-M0083-01 24 Tests

Mini Sample Mouse Gas6 (Growth Arrest Specific Protein 6) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse Gas6 (Growth Arrest Specific Protein 6) ELISA Kit
E-MSEL-M0083-02 48 Tests

Mini Sample Mouse Gas6 (Growth Arrest Specific Protein 6) ELISA Kit

Sign In for Pricing
View Details