Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Spore membrane assembly protein 2 (SMA2)

This Recombinant Saccharomyces cerevisiae Spore membrane assembly protein 2 (SMA2) spans the amino acid sequence from region 1-369.

Product Specifications

Product Name Alternative

Spore membrane assembly protein 2

UniProt

A6ZLZ9

Expression Region

1-369

Origin

Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)

Field of Research

Neuroscience; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLFPKRLIVWGVLLILSLSQFVLYLPATTCTNSKGLRLCAPQFTITVIGGSSTANEFIAS VREFLRLISYLTIDMGWSNEFTDPSVYEDENLVDTFQPDKVFELNYFGFCKRSNKSKVYC TSNENYGMDVLEVLVRDVGIQLGNISTTRSNETKKFGDSLVLTYRLALTSIRDFLKHDKH TGNALSKALIGSPDPNVKGASPTKNYLKGVNLAFILMMFNGMVFYFAVLEIIVGFLSICV VSAFGGALSVGKRHRLFPILLKSSSSILVVIATLTILCNIVYLIALKTLEPEEVTDVGSD NAAVHTTGWELLKVNVGSGFIMGLARYAIQWVLLVLAFLAANHYKAKPKKSDKYTEDTSN SPSPDLMEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
BNC681820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
BNC880050-500 1x 500 µL

IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
BNC880026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF568 conjugate, 0.1mg/mL
BNC680324-500 1x 500 µL

CD53 (161-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF647 conjugate, 0.1mg/mL
BNC470050-500 1x 500 µL

IgA Secretory Component (SC05), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 13 (Non-Keratinized Squamous Epithelial Marker) (KRT13/2213), CF405S conjugate, 0.1mg/mL
BNC042659-100 1x 100 µL

Cytokeratin 13 (Non-Keratinized Squamous Epithelial Marker) (KRT13/2213), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details